Menu

IGF1-Lr3 Canada Peptides

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding.

*All the information below is strictly for research purposes only. Under no circumstance should this chemical be used for human consumption.

66.00$

Compare

Description

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.

IGF-1 LR3 allows many growth factors in the category of IGF’s to increase protein formation through nitrogen retention. The long version is more effective than the original IGF-1; it has an enhanced potency because of increased binding sites. The hormone is effective in accentuating hyperplasia, it is widely known for its activity in the splitting and formation of new muscle cells.  IGF-1 LR3 is a synthetic version of the natural insulin like growth factor but with modification at the position number 3, and an extension at the amino acid number 13 at the B-termini. It is more potent than insulin like growth factor 1. Moreover, research reveals that it has a longer half-life than IGF-1, the polypeptide plays a vital role in muscle renewal and it encourages the production and differential of stem cells. IGF-1LR3 is known to increase satellite activity of the cells, muscle protein content, muscle DNA, and muscle cross sectional area and muscle weight. The essence of the polypeptide lies in the fact that it induces muscles growth by enhancing hyperplasia.

IGF1-LR3 Chemical Profile

CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

The primitive form of the peptide refers to the natural amino acid sequence, which is often formed because of the conformational structure, and the peptide is manufactured by using Escherichia coli. After extraction numerous purifying and chromatographic techniques are used to fold and purify the protein to make igf- 1 LR 3 for sale, this is a high potent and functional form of the polypeptide, and it can bind to several IGF-1 receptors. IGF-1 or insulin-like growthfactor 1 is a peptide hormone that is coded transcriptionally by the IGF-1 gene, and the main center of production is the liver cells or hepatocytes.

Mechanism of Action

Growth hormone has a positive feedback on the production of this hormone from the hepatocytes, in a technical sense, igf-1 lr3 is composed of 70 amino acids in its sequence, and it has three intra-molecular disulfide bridges in the sequence. The peptide shares the molecular configuration and the structure of insulin; it exerts anabolic effects to the body. Igf-1 buy is widely known to utilize the autocrine and paracrine signaling cascades to initiate molecular interaction on the target issues and receptors. According to research, the IGF-1peptide has shown the ability to induce sulfation, and it may cause non-suppressible insulin-like activity or NSILA.

In the modern scientific world, the insulin growth factor 1 is often referred to as somatomedin C. The activity of the IGF-1 is mediated by insulin-like growth factor 1 receptor that is situated in different cells. Differential research indicates that the IGF-1R or the insulin-like growth factor 1 receptor is classified under the tyrosine kinase family of receptors. It is important to note that the ligand binds and activates the intracellular Akt signaling pathway, and the terminal downstream effects include the inhibition of cellular death or apoptosis and the stimulation of cell proliferation, cell division, cell development, and maturity.

Reviews

There are no reviews yet.

Be the first to review “IGF1-Lr3 Canada Peptides”

Pin It on Pinterest

FREE Shipping + 5%

on your first order!

To complete the subscription process, please click the link in the email we just sent you